| Edit |   |
|---|
| Antigenic Specificity | Connexin 45/GJA7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
|---|
| Applications | Immunohistochemistry (IHC), Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-Connexin 45/GJA7 Picoband Antibody. Reactivity: Human, Mouse, Rat No cross reactivity with other proteins |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Connexin 45/GJA7 (91-131aa YLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETE), identical to the related mouse and rat sequences.Subcellular Localization: Cell membrane; Multi-pass membrane protein. Cell junction, gap junction. |
|---|
| Other Names | gap junction gamma-1 protein; Gap junction gamma-1 protein; gap junction gamma-1 protein; gap junction protein gamma 1; Connexin-45; Cx45; Gap junction alpha-7 protein, GJC1; GJC1; CX45; GJA7; GJA7; Cx45 |
|---|
| Gene, Accession # | GJC1, Gene ID: 10052, NCBI: NP_001073852.1, UniProt: P36383 |
|---|
| Catalog # | MBS1750928 |
|---|
| Price | |
|---|
| Order / More Info | Connexin 45/GJA7 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|