| 产品详情 |
| Edit |   |
| Antigenic Specificity | Connexin 45/GJA7 |
| Clone | n/a |
| Host Species | n/a |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Anti-Connexin 45/GJA7 Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Connexin 45/GJA7 (333-363aa ADLEALQREIRMAQERLDLAVQAYSHQNNP H), different from the related mouse and rat sequences by three amino acids.Ig Type: Rabbit IgG |
| Other Names | gap junction gamma-1 protein; Gap junction gamma-1 protein; gap junction gamma-1 protein; gap junction protein gamma 1; Connexin-45; Cx45; Gap junction alpha-7 protein, GJC1; GJC1; CX45; GJA7; GJA7; Cx45 |
| Gene, Accession # | Gene ID: 10052, NCBI: NP_001073852.1, UniProt: P36383 |
| Catalog # | MBS177739 |
| Price | |
| Order / More Info | Connexin 45/GJA7 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Kaba, R. A., Coppen, S. R., Dupont, E., Skepper, J. N., Elneil, S., Haw, M. P., Pepper, J. R., Yacoub, M. H., Rothery, S., Severs, N. J. Comparison of connexin 43, 40 and 45 expression patterns in the developing human and mouse hearts. Cell Commun. Adhesion 8: 339-343, 2001. 2. Tsai, M.-Y., Lan, K.-C., Huang, K.-E., Huang, F.-J., Kung, F.-T., Chang, S.-Y. Significance of mRNA levels of connexin37, connexin43, and connexin45 in luteinized granulosa cells of controlled hyperstimulated follicles |
| 产品资料 |
|
|