Edit |   |
Antigenic Specificity | UPP1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | UPP1 antibody. Specificity: UPP1 antibody was raised against the N terminal of UPP1 |
Immunogen | UPP1 antibody was raised using the N terminal of UPP1 corresponding to a region with amino acids AATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFG |
Other Names | UPP1; UPP1; UPP 1; UPP-1; UDRPASE; UP; UPASE; UPP; UPP1; Uridine Phosphorylase 1, |
Gene, Accession # | UPP1 |
Catalog # | MBS5301610 |
Price | |
Order / More Info | UPP1 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |