| Edit |   |
|---|
| Antigenic Specificity | UPF3B/RENT3B |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-UPF3B/RENT3B Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human UPF3B /RENT3B (416-452aa SEKTEKKEEVVKRDRIRNKDRPAMQLYQPGARSRNRL).Ig Type: Rabbit IgG |
|---|
| Other Names | regulator of nonsense transcripts 3B isoform 2; Regulator of nonsense transcripts 3B; regulator of nonsense transcripts 3B; UPF3 regulator of nonsense transcripts homolog B (yeast); Nonsense mRNA reducing factor 3B; Up-frameshift suppressor 3 homolog B; hUpf3B; Up-frameshift suppressor 3 homolog on chromosome X; hUpf3p-X, UPF3B; UPF3B; MRX62; UPF3X; HUPF3B; MRXS14; RENT3B; UPF3BP1; UPF3BP2; UPF3BP3; Upf3p-X; RENT3B; UPF3X; hUpf3B; hUpf3p-X |
|---|
| Gene, Accession # | UPF3B/RENT3B, Gene ID: 65109, NCBI: NP_075386.1, UniProt: Q9BZI7 |
|---|
| Catalog # | MBS178132 |
|---|
| Price | |
|---|
| Order / More Info | UPF3B/RENT3B Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: UPF3B UPF3 regulator of nonsense transcripts homolog B (yeast). 2. Lykke-Andersen J, Shu MD, Steitz JA (Feb 2001). Human Upf proteins target an mRNA for nonsense-mediated decay when bound downstream of a termination codon. Cell 103 (7): 1121-31. 3. Serin G, Gersappe A, Black JD, Aronoff R, Maquat LE (Jan 2001). Identification and characterization of human orthologues to Saccharomyces cerevisiae Upf2 protein and Upf3 protein (Caenorhabditis elegans SMG-4). Mol Cell Biol 21 ( |
|---|