| Edit |   |
|---|
| Antigenic Specificity | UPF3B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | UPF3B antibody |
|---|
| Immunogen | UPF3B antibody was raised using a synthetic peptide corresponding to a region with amino acids KIDRIPERDKLKDEPKIKVHRFLLQAVNQKNLLKKPEKGDEKELDKREKA |
|---|
| Other Names | UPF3B protein; Regulator of nonsense transcripts 3B; regulator of nonsense transcripts 3B; UPF3 regulator of nonsense transcripts homolog B (yeast); Nonsense mRNA reducing factor 3B; Up-frameshift suppressor 3 homolog B; hUpf3B; Up-frameshift suppressor 3 homolog on chromosome X; hUpf3p-X, UPF3B; UPF3B; MRX62; UPF3X; HUPF3B; MRXS14; RENT3B; RENT3B; UPF3X; hUpf3B; hUpf3p-X |
|---|
| Gene, Accession # | UPF3B, Gene ID: 65109, NCBI: AAI21019.1 |
|---|
| Catalog # | MBS5302217 |
|---|
| Price | |
|---|
| Order / More Info | UPF3B Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|