| Edit |   |
|---|
| Antigenic Specificity | Otospiralin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Otospiralin antibody. Specificity: Otospiralin antibody was raised against the N terminal of OTOS |
|---|
| Immunogen | Otospiralin antibody was raised using the N terminal of OTOS corresponding to a region with amino acids MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNY |
|---|
| Other Names | otospiralin; Otospiralin; otospiralin; otospiralin, OTOS; OTOS; OTOSP; OTOSP |
|---|
| Gene, Accession # | Gene ID: 150677, NCBI: NP_683764.1 |
|---|
| Catalog # | MBS5300898 |
|---|
| Price | |
|---|
| Order / More Info | Otospiralin Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|