| Edit |   |
|---|
| Antigenic Specificity | Lipocalin 12 (LCN12) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | LCN12 may play a role in male fertility. LCN12 may act as a retinoid carrier protein within the epididymis. |
|---|
| Immunogen | Lipocalin 12 antibody was raised using the N terminal of LCN12 corresponding to a region with amino acids GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG |
|---|
| Other Names | 9230102M18Rik |
|---|
| Gene, Accession # | Gene ID: 286256 |
|---|
| Catalog # | ABIN634058 |
|---|
| Price | |
|---|
| Order / More Info | Lipocalin 12 (LCN12) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|