| Edit |   |
|---|
| Antigenic Specificity | Annexin IV |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-Annexin IV Picoband Antibody. Reactivity: Human, Mouse, Rat No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human Annexin IV (119-152aa EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVL), different from the related mouse and rat sequences by three amino acids. |
|---|
| Other Names | annexin A4 isoform a; Annexin A4; annexin A4; annexin A4; 35-beta calcimedin; Annexin IV; Annexin-4; Carbohydrate-binding protein p33/p41; Chromobindin-4; Endonexin I; Lipocortin IV; P32.5; PP4-X; Placental anticoagulant protein II; PAP-II; Protein II, ANXA4; ANXA4; ANX4; P32.5; PIG28; PP4-X; ZAP36; PAP-II; HEL-S-274; ANX4; PAP-II |
|---|
| Gene, Accession # | ANXA4, Gene ID: 307, NCBI: NP_001144.1, UniProt: P09525 |
|---|
| Catalog # | MBS1750885 |
|---|
| Price | |
|---|
| Order / More Info | Annexin IV Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|