| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TAP1 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-TAP1 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human TAP1 (438-471aa RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | antigen peptide transporter 1 isoform 1; Antigen peptide transporter 1; antigen peptide transporter 1; transporter 1, ATP-binding cassette, sub-family B (MDR/TAP); ATP-binding cassette sub-family B member 2; Peptide supply factor 1; Peptide transporter PSF1; PSF-1; Peptide transporter TAP1; Peptide transporter involved in antigen processing 1; Really interesting new gene 4 protein, TAP1; TAP1; APT1; PSF1; ABC17; ABCB2; PSF-1; RING4; TAP1N; D6S114E; TAP1*0102N; ABCB2; PSF1; RING4; Y3; APT1; PSF-1 |
|---|
| Gene, Accession # | TAP1, Gene ID: 6890, NCBI: NP_000584.2, UniProt: Q03518 |
|---|
| Catalog # | MBS177859 |
|---|
| Price | |
|---|
| Order / More Info | TAP1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: TAP1 transporter 1, ATP-binding cassette, sub-family B (MDR/TAP). 2. Bahram S, Arnold D, Bresnahan M, Strominger JL, Spies T (Dec 1991). Two putative subunits of a peptide pump encoded in the human major histocompatibility complex class II region. Proc Natl Acad Sci U S A 88 (22): 10094-8. 3. Bodmer JG, Marsh SG, Albert ED, Bodmer WF, Dupont B, Erlich HA, Mach B, Mayr WR, Parham P, Sasazuki T (Oct 1992). Nomenclature for factors of the HLA system, 1991. WHO Nomenclature Comm |
|---|
| 产品资料 |
|
|