| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KAT13D/CLOCK |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-KAT13D/CLOCK Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human KAT13D/CLOCK (75-109aa QKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEE), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.Ig Type: Rabbit IgG |
|---|
| Other Names | circadian locomoter output cycles protein kaput; Circadian locomoter output cycles protein kaput; circadian locomoter output cycles protein kaput; clock circadian regulator; Class E basic helix-loop-helix protein 8; bHLHe8, CLOCK; CLOCK; KAT13D; bHLHe8; BHLHE8; KIAA0334; hCLOCK; bHLHe8 |
|---|
| Gene, Accession # | KAT13D/CLOCK, Gene ID: 9575, NCBI: NP_001254772.1, UniProt: O15516 |
|---|
| Catalog # | MBS178359 |
|---|
| Price | |
|---|
| Order / More Info | KAT13D/CLOCK Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Dunlap JC (Jan 1999). Molecular bases for circadian clocks. Cell 96 (2): 271-90. 2. King DP, Zhao Y, Sangoram AM, Wilsbacher LD, Tanaka M, Antoch MP, Steeves TD, Vitaterna MH, Kornhauser JM, Lowrey PL, Turek FW, Takahashi JS (May 1997). Positional cloning of the mouse circadian clock gene. Cell 89 (4): 641-653. 3. Vitaterna MH, King DP, Chang AM, Kornhauser JM, Lowrey PL, McDonald JD, Dove WF, Pinto LH, Turek FW, Takahashi JS (Apr 1994). Mutagenesis and mapping of a mouse gene, Clock, es |
|---|
| 产品资料 |
|
|