| Edit |   |
|---|
| Antigenic Specificity | Acetyl-CoA Acetyltransferase 1 (ACAT1) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ACAT1 is a mitochondrially localized enzyme that catalyzes the reversible formation of acetoacetyl-CoA from two molecules of acetyl-CoA. The gene encoding ACAT1 spans approximately 27 kb and contains 12 exons interrupted by 11 introns. Defects in this gene are associated with the alpha-methylacetoaceticaciduria disorder, an inborn error of isoleucine catabolism characterized by urinary excretion of 2-methyl-3-hydroxybutyric acid, 2-methylacetoacetic acid, tiglylglycine, and butanone. |
|---|
| Immunogen | ACAT1 antibody was raised using the middle region of ACAT1 corresponding to a region with amino acids GHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIH |
|---|
| Other Names | ACAT|MAT|T2|THIL|RATACAL|acat1-a|6330585C21Rik|Acat|fd16h07|fd20g06|wu:fd16h07|wu:fd20g06|zgc:86832 |
|---|
| Gene, Accession # | Gene ID: 38 |
|---|
| Catalog # | ABIN631041 |
|---|
| Price | |
|---|
| Order / More Info | Acetyl-CoA Acetyltransferase 1 (ACAT1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|