Edit |   |
Antigenic Specificity | Developmentally Regulated GTP Binding Protein 1 (DRG1) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | DRG1 belongs to the GTP1/OBG family.It may play a role in cell proliferation, differentiation and death. |
Immunogen | DRG1 antibody was raised using the middle region of DRG1 corresponding to a region with amino acids VLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSEL |
Other Names | xdrg1|MGC122865|wu:fb06g12|zgc:64124|NEDD3|AA408859|AI132520|Nedd3|xdrg|CAP43|CMT4D|DRG1|HMSNL|NMSL|Ndr1|Ndrl|PROXY1|RTP|TDD5 |
Gene, Accession # | Gene ID: 4733,17988,305470 |
Catalog # | ABIN631526 |
Price | |
Order / More Info | Developmentally Regulated GTP Binding Protein 1 (DRG1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |