| Edit |   |
|---|
| Antigenic Specificity | LOC653186 (LOC653186) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of LOC653186 protein is not widely studied, and is yet to be elucidated fully. |
|---|
| Immunogen | LOC653186 antibody was raised using the N terminal of LOC653186 corresponding to a region with amino acids MKVINAKLDGFYSFPIFLFQFLQATAQEEGIFECADPKLAISAIWTFRDL |
|---|
| Other Names | n/a |
|---|
| Gene, Accession # | n/a |
|---|
| Catalog # | ABIN629757 |
|---|
| Price | |
|---|
| Order / More Info | LOC653186 (LOC653186) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|