| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EME1 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-EME1 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human EME1 (520-561aa DKERQNLLADIQVRRGEGVTSTSRRIGPELSRRIYLQMTTLQ), different from the related mouse sequence by five amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | crossover junction endonuclease EME1 isoform 1; Crossover junction endonuclease EME1; crossover junction endonuclease EME1; essential meiotic structure-specific endonuclease 1; MMS4 homolog; hMMS4, EME1; EME1; MMS4L; SLX2A; MMS4; hMMS4 |
|---|
| Gene, Accession # | EME1, Gene ID: 146956, NCBI: NP_001159603.1, UniProt: Q96AY2 |
|---|
| Catalog # | MBS177915 |
|---|
| Price | |
|---|
| Order / More Info | EME1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: EME1 essential meiotic endonuclease 1 homolog 1 (S. pombe). 2. Abraham, J., Lemmers, B., Hande, M. P., Moynahan, M. E., Chahwan, C., Ciccia, A., Essers, J., Hanada, K., Chahwan, R., Khaw, A. K., McPherson, P., Shehabeldin, A., Laister, R., Arrowsmith, C., Kanaar, R., West, S. C., Jasin, M., Hakem, R. Eme1 is involved in DNA damage processing and maintenance of genomic stability in mammalian cells. EMBO J. 22: 6137-6147, 2003. 3. Ciccia A, Constantinou A, West SC (Jun 2003). Id |
|---|
| 产品资料 |
|
|