| Edit |   |
| Antigenic Specificity | IDNK |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 53%, rat 55%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | ICC-IF |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human IDNK polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RDILTQGKDGVALKCEESGKEAKQAEMQLLVVHLSGSFEVISGRLLKREGH |
| Other Names | idnK, gluconokinase homolog (E. coli), bA522I20.2, C9orf103 |
| Gene, Accession # | Gene ID: 414328, UniProt: Q5T6J7, ENSG00000148057 |
| Catalog # | HPA058429 |
| Price | |
| Order / More Info | IDNK Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |