| Edit |   |
|---|
| Antigenic Specificity | Solute Carrier Family 25, Member 46 (SLC25A46) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat, zebrafish |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SLC25A46 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane. |
|---|
| Immunogen | SLC25 A46 antibody was raised using the N terminal of SLC25 46 corresponding to a region with amino acids RSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTSTPYEGPTEEP |
|---|
| Other Names | SLC25A46|MGC152354|zgc:92767|slc25a46|1200007B05Rik|AI325987|RGD1305072 |
|---|
| Gene, Accession # | Gene ID: 436831,91137,67453,291709 |
|---|
| Catalog # | ABIN630320 |
|---|
| Price | |
|---|
| Order / More Info | Solute Carrier Family 25, Member 46 (SLC25A46) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|