| Edit |   |
|---|
| Antigenic Specificity | Family with Sequence Similarity 154, Member A (FAM154A) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of Chromosome 9 ORF protein is not widely studied, and is yet to be elucidated fully. |
|---|
| Immunogen | C9 ORF138 antibody was raised using the N terminal Of C9 rf138 corresponding to a region with amino acids SEYTENYPFYHSYLPRESFKPRREYQKGSIPMEGLTTSRRDFGPHKVAPV |
|---|
| Other Names | C9orf138|4930500O09Rik|Fam154a |
|---|
| Gene, Accession # | Gene ID: 158297 |
|---|
| Catalog # | ABIN632111 |
|---|
| Price | |
|---|
| Order / More Info | Family with Sequence Similarity 154, Member A (FAM154A) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|