Edit |   |
Antigenic Specificity | Family with Sequence Similarity 109, Member A (FAM109A) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | the FAM109A protein localizes to the endosome and interacts with the enzyme, inositol polyphosphate 5-phosphatase OCRL-1. Alternate splicing results in multiple transcript variants. |
Immunogen | FAM109 A antibody was raised using the N terminal of FAM109 corresponding to a region with amino acids HRRWFVLRGNMLFYFEDAASREPVGVIILEGCTVELVEAAEEFAFAVRFA |
Other Names | IPIP27A|SES1|A230106M15Rik|AU017694|Ses1|RGD1310656 |
Gene, Accession # | Gene ID: 144717 |
Catalog # | ABIN632583 |
Price | |
Order / More Info | Family with Sequence Similarity 109, Member A (FAM109A) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |