Edit |   |
Antigenic Specificity | Family with Sequence Similarity 118, Member A (FAM118A) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The function of FAM118 protein is not widely studied, and is yet to be elucidated fully. |
Immunogen | FAM118 A antibody was raised using the middle region of FAM118 corresponding to a region with amino acids EVMEVLQNLYRTKSFLFVGCGETLRDQIFQALFLYSVPNKVDLEHYMLVL |
Other Names | C22orf8|3110048E14Rik|C230014M12Rik |
Gene, Accession # | Gene ID: 55007 |
Catalog # | ABIN633127 |
Price | |
Order / More Info | Family with Sequence Similarity 118, Member A (FAM118A) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |