Edit |   |
Antigenic Specificity | Family with Sequence Similarity 71, Member A (FAM71A) (C-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | FAM71A belongs to the FAM71 family. The exact function of C15orf27 remains unknown. |
Immunogen | FAM71 A antibody was raised using the C terminal of FAM71 corresponding to a region with amino acids DKIAQKSSSRSSFSHRANRDDKKEKGCGNPGSSRHRDSHKGVSHTPISKE |
Other Names | RGD1561646|GARI-L4|4933417M04Rik|RP11-338C15.4 |
Gene, Accession # | Gene ID: 149647 |
Catalog # | ABIN632763 |
Price | |
Order / More Info | Family with Sequence Similarity 71, Member A (FAM71A) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |