| Edit |   |
|---|
| Antigenic Specificity | AKR1B10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
|---|
| Applications | Immunohistochemistry (IHC), Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-AKR1B10 Picoband Antibody. Reactivity: Human No cross reactivity with other proteins |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human AKR1B10 (285-316aa EMATILSFNRNWRACNVLQSSHLEDYPFNAEY).Subcellular Localization: Lysosome. Secreted. Secreted through a lysosome-mediated non-classical pathway.Tissue Specificity: Found in many tissues. Highly expressed in sm |
|---|
| Other Names | aldo-keto reductase family 1 member B10; Aldo-keto reductase family 1 member B10; aldo-keto reductase family 1 member B10; aldo-keto reductase family 1 member B10; ARL-1; Aldose reductase-like; Aldose reductase-related protein; ARP; hARP; Small intestine reductase; SI reductase, AKR1B10; AKR1B10; HIS; HSI; ARL1; ARL-1; ALDRLn; AKR1B11; AKR1B12; AKR1B11; ARP; hARP; SI reductase |
|---|
| Gene, Accession # | AKR1B10, Gene ID: 57016, NCBI: NP_064695.3, UniProt: O60218 |
|---|
| Catalog # | MBS1750806 |
|---|
| Price | |
|---|
| Order / More Info | AKR1B10 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|