| Edit |   |
|---|
| Antigenic Specificity | Endonuclease G (ENDOG) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ENDOG cleaves DNA at double-stranded (DG)n.(DC)n and at single-stranded (DC)n tracts. In addition to deoxyribonuclease activities, ENDOG also has ribonuclease (RNase) and RNase H activities. ENDOG is capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA. |
|---|
| Immunogen | ENDOG antibody was raised using the middle region of ENDOG corresponding to a region with amino acids YVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGS |
|---|
| Other Names | CG8862|Dmel\\CG8862|Tb08.10J17.140|Tb08.10J17.90|TBC1D13|endog|ENDOG|wu:fb79c08|zgc:110020 |
|---|
| Gene, Accession # | Gene ID: 2021,13804,362100 |
|---|
| Catalog # | ABIN633888 |
|---|
| Price | |
|---|
| Order / More Info | Endonuclease G (ENDOG) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|