| Edit |   |
|---|
| Antigenic Specificity | Oxysterol Binding Protein-Like 9 (OSBPL9) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, dog |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | OSBPL9 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain. |
|---|
| Immunogen | OSBPL9 antibody was raised using the N terminal of OSBPL9 corresponding to a region with amino acids HQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADE |
|---|
| Other Names | OSBPL9|osbpl9|MGC145585|ORP-9|DKFZp469M1123|ORP9|zgc:154069|2600011I06Rik|AU015843|Orp-9 |
|---|
| Gene, Accession # | Gene ID: 114883,475355 |
|---|
| Catalog # | ABIN631464 |
|---|
| Price | |
|---|
| Order / More Info | Oxysterol Binding Protein-Like 9 (OSBPL9) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|