Edit |   |
Antigenic Specificity | Oxysterol Binding Protein-Like 8 (OSBPL8) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | OSBPL8 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, OSBPL8 contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. |
Immunogen | OSBPL8 antibody was raised using the middle region of OSBPL8 corresponding to a region with amino acids YSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQSSIESIKQTQEEIKR |
Other Names | RGD1561474|DKFZp469P0923|MST120|MSTP120|ORP8|OSBP10|AA536976|AA536995|C730029P18Rik|D330025H14Rik|ORP-8 |
Gene, Accession # | Gene ID: 114882 |
Catalog # | ABIN635299 |
Price | |
Order / More Info | Oxysterol Binding Protein-Like 8 (OSBPL8) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |