| Edit |   |
|---|
| Antigenic Specificity | ZFAND2B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 89%, rat 91%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human ZFAND2B polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: NGLSEDEALQRALEMSLAETKPQVPSCQEEEDLALAQALSASEAEYQRQQAQSRSSKPSNCSLC |
|---|
| Other Names | zinc finger, AN1-type domain 2B, AIRAPL |
|---|
| Gene, Accession # | Gene ID: 130617, UniProt: Q8WV99, ENSG00000158552 |
|---|
| Catalog # | HPA035159 |
|---|
| Price | |
|---|
| Order / More Info | ZFAND2B Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|