| Edit |   |
| Antigenic Specificity | MYL6B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 84%, rat 86%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues., Recombinant expression validation in WB using target protein overexpression. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human MYL6B polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: APPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKE |
| Other Names | myosin, light chain 6B, alkali, smooth muscle and non-muscle, MLC1SA |
| Gene, Accession # | Gene ID: 140465, UniProt: P14649, ENSG00000196465 |
| Catalog # | HPA038887 |
| Price | |
| Order / More Info | MYL6B Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |