Edit |   |
Antigenic Specificity | Isoprenoid Synthase Domain Containing (ISPD) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The specific function of hCG_1745121 is not yet known. |
Immunogen | HCG_1745121 antibody was raised using the N terminal Of Hcg_1745121 corresponding to a region with amino acids MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKP |
Other Names | MDDGA7|Nip|4930579E17Rik|AV040780|sb:eu371|zgc:154151 |
Gene, Accession # | Gene ID: 729920 |
Catalog # | ABIN632476 |
Price | |
Order / More Info | Isoprenoid Synthase Domain Containing (ISPD) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |