| Edit |   |
|---|
| Antigenic Specificity | Isoleucyl-tRNA Synthetase (IARS) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Isoleucine-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family and has been identified as a target of autoantibodies in the autoimmune disease polymyositis/dermatomyositis. Two alternatively spliced variants have been isolated that represent alternate 5' UTRs. |
|---|
| Immunogen | IARS antibody was raised using the middle region of IARS corresponding to a region with amino acids YEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTAD |
|---|
| Other Names | fi46h05|zgc:63790|wu:fi46h05|K19E20.18|K19E20_18|ovule abortion 2|ECK0027|ilvS|JW0024|An08g06770|AO090012000505|2510016L12Rik|AI327140|AU044614|E430001P04Rik|ILRS|Iarsl|IARS1|ILERS|IRS|PRO0785 |
|---|
| Gene, Accession # | Gene ID: 3376 |
|---|
| Catalog # | ABIN631746 |
|---|
| Price | |
|---|
| Order / More Info | Isoleucyl-tRNA Synthetase (IARS) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|