| 产品详情 |
| Edit |   |
| Antigenic Specificity | MUDENG |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MUDENG Antibody from Novus Biologicals is a rabbit polyclonal antibody to MUDENG. This antibody reacts with human. The MUDENG Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MUDENG antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CPFGTLLDANLQNSLDNTNFASVTQPQKQPAWKTGTYKGKPQVSISITEKVKSMQYDKQGIADTWQVVGTVTCKCDLEGIMPNVTISLSLPT |
| Other Names | Adapter-Related Protein Complex 5 Mu Subunit, Adaptor-Related Protein Complex 5, Mu 1 Subunit, AP-5 Complex Subunit Mu, AP-5 Complex Subunit Mu-1, C14orf108, Chromosome 14 Open Reading Frame 108, MHD Domain-Containing Death-Inducing Protein, Mu-2 Related Death-Inducing, Mu-2 Related Death-Inducing Gene, MU-2/AP1M2 Domain Containing, Death-Inducing, Mu-2-Related Death-Inducing Protein, Mu5, MuD, Putative HIV-1 Infection-Related Protein |
| Gene, Accession # | AP5M1, Gene ID: 55745, Accession: Q9H0R1, SwissProt: Q9H0R1 |
| Catalog # | NBP2-33815 |
| Price | |
| Order / More Info | MUDENG Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|