| 产品详情 |
| Edit |   |
| Antigenic Specificity | mu Crystallin |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The mu Crystallin Antibody from Novus Biologicals is a rabbit polyclonal antibody to mu Crystallin. This antibody reacts with human. The mu Crystallin Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human mu Crystallin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YEIFTEQFSFKEVRIWNRTKENAEKFADTVQGEVRVCSSVQEAVAGADVIITVTLATEPILFGEWVKPGAHINAVGASRPDWRE |
| Other Names | crystallin, mu, DFNA40NADP-regulated thyroid-hormone binding protein, mu-crystallin homolog, NADP-regulated thyroid-hormone-binding protein, THBP |
| Gene, Accession # | CRYM, Gene ID: 1428 |
| Catalog # | NBP2-55172 |
| Price | |
| Order / More Info | mu Crystallin Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|