| 产品详情 |
| Edit |   |
| Antigenic Specificity | Integrin alpha 3B |
| Clone | PB36 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG1 |
| Format | DyLight 488 conjugate |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Integrin alpha 3B Antibody (PB36) [DyLight 488] from Novus Biologicals is a mouse monoclonal antibody to Integrin alpha 3B. This antibody reacts with human. The Integrin alpha 3B Antibody (PB36) [DyLight 488] has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen. Specificity: PB36 recognizes the cytoplasmic domain of integrin subunits alpha3B and alpha6B |
| Immunogen | Clone PB36 is a mouse monoclonal IgG1, kappa antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha 3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin. |
| Other Names | AA407068, CD49C, GAPB3, integrin alpha 3 |
| Gene, Accession # | ITGA3, Gene ID: 3675 |
| Catalog # | NBP1-97731G |
| Price | |
| Order / More Info | Integrin alpha 3B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|