| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Integrin alpha 3B |
|---|
| Clone | 54B3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 |
|---|
| Format | Alexa Fluor 594 conjugate |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen. Optimal dilution of this antibody should be experimentally determined. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Integrin alpha 3B Antibody (54B3) [Alexa Fluor® 594] from Novus Biologicals is a mouse monoclonal antibody to Integrin alpha 3B. This antibody reacts with human. The Integrin alpha 3B Antibody (54B3) [Alexa Fluor® 594] has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen. Specificity: 54B3 recognizes specifically the cytoplasmic domain of integrin subunit alpha3B |
|---|
| Immunogen | Clone 54B3 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin. |
|---|
| Other Names | AA407068, CD49C, GAPB3, integrin alpha 3 |
|---|
| Gene, Accession # | ITGA3, Gene ID: 3675 |
|---|
| Catalog # | NBP1-97732AF594 |
|---|
| Price | |
|---|
| Order / More Info | Integrin alpha 3B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|