| Edit |   |
| Antigenic Specificity | Integrin alpha 8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Integrin alpha 8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Integrin alpha 8. This antibody reacts with human. The Integrin alpha 8 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to ITGA8(integrin, alpha 8) The peptide sequence was selected from the N terminal of ITGA8. Peptide sequence GEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSI. |
| Other Names | integrin alpha-8, integrin, alpha 8 |
| Gene, Accession # | ITGA8, Gene ID: 8516, Accession: P53708, SwissProt: P53708 |
| Catalog # | NBP1-59940-20ul |
| Price | |
| Order / More Info | Integrin alpha 8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |