| Edit |   |
| Antigenic Specificity | Integrin alpha 7 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Integrin alpha 7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Integrin alpha 7. This antibody reacts with rat. The Integrin alpha 7 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to the N terminal of Itga7. Immunizing peptide sequence CQQGTAATFSPDSHYLIFGAPGTYNWKGLLFVTNIDSSDPDQLVYKTLDP. |
| Other Names | FLJ25220, integrin alpha 7 chain, integrin alpha-7, integrin, alpha 7 |
| Gene, Accession # | ITGA7, Gene ID: 3679, Accession: Q63258 |
| Catalog # | NBP1-74207 |
| Price | |
| Order / More Info | Integrin alpha 7 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |