| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Integrin alpha 7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, bovine |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunocytochemistry. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Integrin alpha 7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Integrin alpha 7. This antibody reacts with human, bovine. The Integrin alpha 7 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunocytochemistry. Specificity of human Integrin alpha 7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FACPLSLEETDCYRVDIDQGADMQKESKENQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGEWKFCE |
|---|
| Other Names | FLJ25220, integrin alpha 7 chain, integrin alpha-7, integrin, alpha 7 |
|---|
| Gene, Accession # | ITGA7, Gene ID: 3679 |
|---|
| Catalog # | NBP1-86118 |
|---|
| Price | |
|---|
| Order / More Info | Integrin alpha 7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|