| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Prohibitin 2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Prohibitin 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Prohibitin 2. This antibody reacts with human, mouse, rat. The Prohibitin 2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat Prohibitin 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRA AQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK |
|---|
| Other Names | BAP, Bap37, BCAP37, B-cell associated protein, D-prohibitin, MGC117268, p22, PNAS-141, prohibitin 2, prohibitin-2, REAB-cell receptor-associated protein BAP37, Repressor of estrogen receptor activity |
|---|
| Gene, Accession # | PHB2, Gene ID: 11331 |
|---|
| Catalog # | NBP2-13754 |
|---|
| Price | |
|---|
| Order / More Info | Prohibitin 2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|