| 产品详情 |
| Edit |   |
| Antigenic Specificity | PRMT5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PRMT5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRMT5. This antibody reacts with human. The PRMT5 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PRMT5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENA |
| Other Names | EC 2.1.1.-, EC 2.1.1.125, Histone-arginine N-methyltransferase PRMT5, HMT1 hnRNP methyltransferase-like 5,72 kDa ICln-binding protein, HRMT1L5, IBP72, Jak-binding protein 1, JBP1, protein arginine methyltransferase 5, protein arginine N-methyltransferase 5, Shk1 kinase-binding protein 1 homolog, SKB1, skb1 (S. pombe) homolog, SKB1 homolog (S. pombe), SKB1HsSKB1 homolog |
| Gene, Accession # | PRMT5, Gene ID: 10419 |
| Catalog # | NBP2-56041 |
| Price | |
| Order / More Info | PRMT5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|