| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PRMT3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Chromatin Immunoprecipitation |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PRMT3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRMT3. This antibody reacts with human. The PRMT3 Antibody has been validated for the following applications: Western Blot, Chromatin Immunoprecipitation. |
|---|
| Immunogen | Synthetic peptides corresponding to PRMT3(protein arginine methyltransferase 3) The peptide sequence was selected from the middle region of PRMT3. Peptide sequence LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWK. |
|---|
| Other Names | EC 2.1.1, EC 2.1.1.-, heterogeneous nuclear ribonucleoprotein methyltransferase-like 3, Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3, HMT1 hnRNP methyltransferase-like 3, HMT1 hnRNP methyltransferase-like 3 (S. cerevisiae), HRMT1L3, protein arginine methyltransferase 3, protein arginine N-methyltransferase 3 |
|---|
| Gene, Accession # | PRMT3, Gene ID: 10196, Accession: O60678, SwissProt: O60678 |
|---|
| Catalog # | NBP1-55399-20ul |
|---|
| Price | |
|---|
| Order / More Info | PRMT3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|