| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PRMT2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PRMT2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRMT2. This antibody reacts with human, mouse. The PRMT2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to PRMT2 (protein arginine methyltransferase 2) The peptide sequence was selected from the N terminal of PRMT2 (NP_001526). Peptide sequence ESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILIL. |
|---|
| Other Names | EC 2.1.1.-, EC 2.1.1.125, Histone-arginine N-methyltransferase PRMT2, HMT1, HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 1, HMT1 hnRNP methyltransferase-like 1, HMT1 hnRNP methyltransferase-like 1 (S. cerevisiae), HRMT1L1PRMT2 beta, MGC111373, PRMT2 alpha, PRMT2 gamma, protein arginine methyltransferase 2, protein arginine N-methyltransferase 2 |
|---|
| Gene, Accession # | PRMT2, Gene ID: 3275, Accession: P55345, SwissProt: P55345 |
|---|
| Catalog # | NBP1-52944 |
|---|
| Price | |
|---|
| Order / More Info | PRMT2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 12039952 |
|---|
| 产品资料 |
|
|