| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Aconitase 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 25647178). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. Western Blot verified by a customer review. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Aconitase 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Aconitase 1. This antibody reacts with human, mouse, rat. The Aconitase 1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat Aconitase 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK |
|---|
| Other Names | Aconitase, aconitase 1, soluble, aconitate hydratase, Citrate hydro-lyase, cytoplasmic aconitate hydratase, EC 4.2.1, EC 4.2.1.3, Ferritin repressor protein, IREB1IREBP1, IREBP, IRE-BP 1, Iron regulatory protein 1, iron-responsive element binding protein 1, Iron-responsive element-binding protein 1, IRP1ACONS |
|---|
| Gene, Accession # | ACO1, Gene ID: 48 |
|---|
| Catalog # | NBP1-87677 |
|---|
| Price | |
|---|
| Order / More Info | Aconitase 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23155415, 25647178 |
|---|
| 产品资料 |
|
|