| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | INO80 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The INO80 Antibody from Novus Biologicals is a rabbit polyclonal antibody to INO80. This antibody reacts with human. The INO80 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human INO80 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CTELAKPLYLQYLERALRLDHFLRQTSAIFNRNISSDDSEDGLDDSNPLLPQSGDPLIQVKEEPPNSLLGETSGAGSSGMLNTYSLNGVLQS |
|---|
| Other Names | EC 3.6.1, EC 3.6.1.23, EC 3.6.4.12, hINO80INO80 complex subunit A, homolog of yeast INO80, Ino80, INO80 complex homolog 1 (S. cerevisiae), INO80 homolog (S. cerevisiae), INO80A, INOC1putative DNA helicase INO80 complex homolog 1, KIAA1259 |
|---|
| Gene, Accession # | INO80, Gene ID: 54617 |
|---|
| Catalog # | NBP2-58963 |
|---|
| Price | |
|---|
| Order / More Info | INO80 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|