| Edit |   |
| Antigenic Specificity | ADGB |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ADGB Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADGB. This antibody reacts with human. The ADGB Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ADGB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DGLNLEREIVSQTTATQEKSQEELPTTNNSVSKEIWLDFEDFCVCFQNIYIFHKPSSYCLNFQKSEFKFSEERVSYYLFVDSLKPIELLVCFSALVR |
| Other Names | androglobin, C6orf103, Calpain-7-Like Protein, CAPN7L, Chromosome 6 Open Reading Frame 103 |
| Gene, Accession # | ADGB, Gene ID: 79747, Accession: Q8N7X0, SwissProt: Q8N7X0 |
| Catalog # | NBP2-37881 |
| Price | |
| Order / More Info | ADGB Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |