| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Adenylosuccinate Synthase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Adenylosuccinate Synthase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Adenylosuccinate Synthase. This antibody reacts with human, mouse, rat. The Adenylosuccinate Synthase Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat Adenylosuccinate Synthase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KLDGEIIPHIPANQEVLNKVEVQYKTLPGWNTDISNARAFKELPVNAQNYVRFIEDELQIPVKWIGVGKSRESM |
|---|
| Other Names | ADEH, adenylosuccinate synthase, adenylosuccinate synthetase (Ade(-)H-complementing), adenylosuccinate synthetase isozyme 2, Adenylosuccinate synthetase, acidic isozyme, Adenylosuccinate synthetase, liver isozyme, AdSS 2, ADSS2, AMPSase 2, EC 6.3.4.4, IMP--aspartate ligase 2, L-type adenylosuccinate synthetase, MGC20404 |
|---|
| Gene, Accession # | ADSS, Gene ID: 159, Accession: P30520, SwissProt: P30520 |
|---|
| Catalog # | NBP1-90360 |
|---|
| Price | |
|---|
| Order / More Info | Adenylosuccinate Synthase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23435261 |
|---|
| 产品资料 |
|
|