| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ACAT2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ACAT2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACAT2. This antibody reacts with human, mouse. The ACAT2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse ACAT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SIGIGDSSIVVAGGMENMSKAPHLAYLRTGVKIGEMPLTDSILCDGLTDAFHNCHMGITAENVAKKWQVSREDQDKVAVLS |
|---|
| Other Names | acetoacetyl Coenzyme A thiolase, acetyl-CoA acetyltransferase 2, acetyl-CoA acetyltransferase, cytosolic, Acetyl-CoA transferase-like protein, acetyl-Coenzyme A acetyltransferase 2, acetyl-Coenzyme A acetyltransferase 2 (acetoacetyl Coenzyme A thiolase), ACTL, Cytosolic acetoacetyl-CoA thiolase, EC 2.3.1, EC 2.3.1.9 |
|---|
| Gene, Accession # | ACAT2, Gene ID: 39, Accession: Q9BWD1, SwissProt: Q9BWD1 |
|---|
| Catalog # | NBP1-89525 |
|---|
| Price | |
|---|
| Order / More Info | ACAT2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24506864 |
|---|
| 产品资料 |
|
|