| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ACAT |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ACAT Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACAT. This antibody reacts with human. The ACAT Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ACAT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEELKPF |
|---|
| Other Names | ACACT, ACACT1, ACAT-1, ACATACAT1, acyl-Coenzyme A: cholesterol acyltransferase, Acyl-coenzyme A:cholesterol acyltransferase 1, Cholesterol acyltransferase 1, EC 2.3.1.26, RP11-215I23.2, STATSOAT, sterol O-acyltransferase (acyl-Coenzyme A: cholesterol acyltransferase) 1, sterol O-acyltransferase 1 |
|---|
| Gene, Accession # | SOAT1, Gene ID: 6646, Accession: P35610, SwissProt: P35610 |
|---|
| Catalog # | NBP2-32052 |
|---|
| Price | |
|---|
| Order / More Info | ACAT Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|