| 产品详情 |
| Edit |   |
| Antigenic Specificity | ACAP4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ACAP4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACAP4. This antibody reacts with human. The ACAP4 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ACAP4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTPEPQRLWTAICNRDLLSVLEAFA |
| Other Names | ARF6 GTPase-activating protein, arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3, ArfGAP with SH3 domain, ankyrin repeat and PH domain 3, ArfGAP with SH3 domain, ankyrin repeat and PH domain 3 1, centaurin, beta 6, CENTB6, DDEFL1, development and differentiation enhancing factor-like 1, Development and differentiation-enhancing factor-like 1, FLJ20199, Protein up-regulated in liver cancer 1, UPLC1ACAP4, up-regulated in liver cancer 1 (UPLC1) |
| Gene, Accession # | ASAP3, Gene ID: 55616 |
| Catalog # | NBP2-48550 |
| Price | |
| Order / More Info | ACAP4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|