| Edit |   |
|---|
| Antigenic Specificity | TTC6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TTC6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TTC6. This antibody reacts with human. The TTC6 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TTC6(tetratricopeptide repeat domain 6) The peptide sequence was selected from the C terminal of TTC6. Peptide sequence MKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEY. |
|---|
| Other Names | C14orf25, NCRNA00291, TTC6 tetratricopeptide repeat domain 6 |
|---|
| Gene, Accession # | TTC6, Gene ID: 319089, Accession: Q86TZ1, SwissProt: Q86TZ1 |
|---|
| Catalog # | NBP1-54927-20ul |
|---|
| Price | |
|---|
| Order / More Info | TTC6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|