| Edit |   |
|---|
| Antigenic Specificity | TTC6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TTC6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TTC6. This antibody reacts with human. The TTC6 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human TTC6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NEYVLMNRAITNTILKKYEEAKEDFANVIESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQALDL |
|---|
| Other Names | C14orf25, NCRNA00291, TTC6 tetratricopeptide repeat domain 6 |
|---|
| Gene, Accession # | TTC6, Gene ID: 319089 |
|---|
| Catalog # | NBP2-49592 |
|---|
| Price | |
|---|
| Order / More Info | TTC6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|