| Edit |   |
|---|
| Antigenic Specificity | TTC5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TTC5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TTC5. This antibody reacts with human. The TTC5 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TTC5(tetratricopeptide repeat domain 5) The peptide sequence was selected from the C terminal of TTC5. Peptide sequence GDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNGKPQGSSSQAV. |
|---|
| Other Names | Strap, tetratricopeptide repeat domain 5, tetratricopeptide repeat protein 5, TPR repeat protein 5 |
|---|
| Gene, Accession # | TTC5, Gene ID: 91875, Accession: Q8N0Z6, SwissProt: Q8N0Z6 |
|---|
| Catalog # | NBP1-53012-20ul |
|---|
| Price | |
|---|
| Order / More Info | TTC5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|