| 产品详情 |
| Edit |   |
| Antigenic Specificity | TTC33 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TTC33 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TTC33. This antibody reacts with human. The TTC33 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TTC33 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EQQKVAQRIKKSEAPAEVTHFSPKSIPDYDFESDEIVAVCAAIAEKEKTVSANKTMVIVSASGAIETVTEKEDGATPPDGSV |
| Other Names | osmosis responsive factor, Osmosis-responsive factor, OSRF, tetratricopeptide repeat domain 33, tetratricopeptide repeat protein 33, TPR repeat protein 33 |
| Gene, Accession # | TTC33, Gene ID: 23548 |
| Catalog # | NBP1-82468 |
| Price | |
| Order / More Info | TTC33 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|